You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329778 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZYX |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZYX |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | ZYX |
UniProt ID | Q15942 |
Protein Sequence | Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE |
NCBI | NP_003452 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ESP-2 antibody, anti HED-2 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic (cytoskeleton), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.
Rabbit Anti-ZYX Antibody, Catalog Number: orb329778, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in mitochondria, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-ZYX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Human Stomach.
WB Suggested Anti-ZYX antibody Titration: 1 ug/mL, Sample Type: Human heart.
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating