You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334645 |
---|---|
Category | Antibodies |
Description | ZP2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 82357 MW |
UniProt ID | Q05996 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Zona pellucida sperm-binding protein 2;Zona pelluc Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of ZP2 using anti-ZP2 antibody.Lane 1:HELA cell; 2:HEPG2 cell.
IHC analysis of ZP2 using anti-ZP2 antibody. ZP2 was detected in a paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of ZP2 using anti-ZP2 antibody.ZP2 was detected in frozen section of human placenta tissue.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating