You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581094 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF433 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF433 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 77kDa |
Target | ZNF433 |
UniProt ID | Q8N7K0 |
Protein Sequence | Synthetic peptide located within the following region: GEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQT |
NCBI | NP_001073880 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FLJ40981 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZNF433 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
ICC, IF, IHC | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating