You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575583 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF165 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF165 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | ZNF165 |
UniProt ID | P49910 |
Protein Sequence | Synthetic peptide located within the following region: ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV |
NCBI | NP_003438 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CT53, LD65, ZSCAN7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ZNF165 antibody (orb575583).
WB Suggested Anti-ZNF165 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.
Filter by Rating