You have no items in your shopping cart.
Cart summary
ZNF148 Peptide - middle region
Catalog Number: orb1998923
| Catalog Number | orb1998923 |
|---|---|
| Category | Proteins |
| Description | ZNF148 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 87 kDa |
| UniProt ID | Q9UQR1 |
| Protein Sequence | Synthetic peptide located within the following region: LKHKRMCHENHDKKLNRCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKT |
| NCBI | NP_068799.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | BERF-1, BFCOL1, ZBP-89, ZFP148, pHZ-52, HT-BETA Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
