You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329864 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZFP42 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | ZFP42 |
UniProt ID | Q96MM3 |
Protein Sequence | Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC |
NCBI | NP_777560 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti REX1 antibody, anti ZNF754 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZFP42 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Host: Rabbit, Target Name: ZFP42, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target Name: ZFP42, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: ZFP42, Sample Type: 721_B Whole cell lysates, Antibody Dilution: 1.0 ug/mL.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating