You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575061 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZFP36 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34 kDa |
Target | ZFP36 |
UniProt ID | P26651 |
Protein Sequence | Synthetic peptide located within the following region: PLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFA |
NCBI | NP_003398 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TTP, G0S24, GOS24, TIS11, NUP475, zfp-36, RNF162A Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommeded dilution for this antibody is 1-3 ug/ml.
Host: Rabbit, Target Name: TTP, Sample Type: Fetal Lung lysates, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: ZFP36, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: ZFP36, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
FC, IH, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
Filter by Rating