You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324538 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZFAND6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZFAND6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | ZFAND6 |
UniProt ID | Q6FIF0 |
Protein Sequence | Synthetic peptide located within the following region: LTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQK |
NCBI | NP_061879 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AWP1 antibody, anti ZA20D3 antibody, anti ZFA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Stomach tissue using ZFAND6 antibody
WB Suggested Anti-ZFAND6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Stomach.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating