You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330041 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZEB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZEB2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25 kDa |
Target | ZEB2 |
UniProt ID | O60315 |
Protein Sequence | Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME |
NCBI | NP_055610 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti KIAA0569 antibody, anti SIP-1 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation.
Host: Rabbit, Target Name: ZEB2, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: ZEB2, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: ZEB2, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL.
WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC, IHC-Fr, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating