ZEB1 monoclonal antibody (M01), clone 4C4

• Catalog Number: orb2292083
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ZEB1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ZEB1 (NP_110378, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
• NCBI: NP_110378
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ZEB1 is 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunofluorescence of monoclonal antibody to ZEB1 on U-2 OS cell. [antibody concentration 10 ug/ml]

U-2 OS cells were stained with ZEB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).

Western Blot detection against Immunogen (36.74 KDa).