ZDHHC4 Rabbit Polyclonal Antibody

• Catalog Number: orb589045
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZDHHC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of rat ZDHHC4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39 kDa
• Target: ZDHHC4
• UniProt ID: F1LQN6
• Protein Sequence: Synthetic peptide located within the following region: LAFPRIIFLLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQH
• NCBI: NP_001013141.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Muscle lysates, Antibody Dilution: 1.0 ug/ml.