You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324428 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZBTB7B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZFP67 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | ZBTB7B |
UniProt ID | O15156 |
Protein Sequence | Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP |
NCBI | NP_056956 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti THPOK antibody, anti ZFP67 antibody, anti ZBT Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: ZFP67, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Host: Rabbit, Target Name: ZFP67, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target: ZBTB7B, Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.
Human Heart
Human Lung
WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0 ug/mL, Positive Control: HepG2 cell lysate.
Filter by Rating