YY1 Antibody (monoclonal, 3F3E7)

• Catalog Number: orb1145860
• Category: Antibodies
• Description: YY1 Antibody (monoclonal, 3F3E7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F3E7
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 65 kDa
• UniProt ID: P25490
• Sensitivity: > 5000 cells
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Dihydrofolate reductase; DHFR
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human thyroid cancer tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinomas tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human ovarian serous cancer tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human serous adenocarcinoma of ovary tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human the muscular layer of a colonic adenocarcinoma tissue.

IF analysis of YY1 using anti-YY1 antibody.YY1 was detected in an immunocytochemical section of T-47D cells.

Western blot analysis of YY1 using anti-YY1 antibody.

Flow Cytometry analysis of A431 cells using anti-YY1 antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.