YTHDF2 antibody

• Catalog Number: orb586914
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YTHDF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human YTHDF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62 kDa
• Target: YTHDF2
• UniProt ID: Q9Y5A9
• Protein Sequence: Synthetic peptide located within the following region: QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
• NCBI: NP_057342
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DF2, CAHL, HGRG8, NY-REN-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml for this antibody.

Host: Rabbit, Target Name: YTHDF2, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: YTHDF2, Sample Type: Jurkat Whole cell lysates, Antibody dilution: 1.0 ug/ml. YTHDF2 is supported by BioGPS gene expression data to be expressed in Jurkat.