YTHDF1 antibody

• Catalog Number: orb583420
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YTHDF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human YTHDF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61 kDa
• Target: YTHDF1
• UniProt ID: Q9BYJ9
• Protein Sequence: Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA
• NCBI: NP_060268
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DF1, C20orf21
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 2 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: YTHDF1, Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-YTHDF1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. YTHDF1 is supported by BioGPS gene expression data to be expressed in HepG2.