You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588767 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to YME1L1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YME1L1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 85 kDa |
Target | YME1L1 |
UniProt ID | Q96TA2 |
Protein Sequence | Synthetic peptide located within the following region: MGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTL |
NCBI | NP_001240795.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FTSH, MEG4, PAMP, OPA11, YME1L Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: YME1L1, Sample Tissue: Stomach Tumor lysates, Antibody Dilution: 1 ug/ml.
FC, IHC-P, WB | |
Mouse, Rat | |
Hamster, Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating