You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581119 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to YAP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human YAP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | YAP1 |
UniProt ID | P46937 |
Protein Sequence | Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |
NCBI | NP_001123617 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | YAP, YKI, COB1, YAP2, YAP65 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: YAP1, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: YAP1, Sample Type: Fetal Liver lysates, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: YAP1, Sample Type: Human Fetal Lung cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.
Host: Rabbit, Target: YAP1, Positive control (+): HepG2 (HG), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.
Human Prostate
Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-YAP1 antibody (orb581119).
WB Suggested Anti-YAP1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating