You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573800 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to XBP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Animal, Bovine, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human XBP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29 kDa |
Target | XBP1 |
UniProt ID | P17861 |
Protein Sequence | Synthetic peptide located within the following region: TQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN |
NCBI | NP_005071 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | XBP2, TREB5, XBP-1, TREB-5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 34 kDa.
Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. XBP1 is supported by BioGPS gene expression data to be expressed in MCF7.
Host: Rabbit, Target Name: XBP1, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: XBP1, Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 0.5 ug/ml.
WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
ELISA, ICC, IF, IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating