You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2055576 |
---|---|
Category | Proteins |
Description | X Recombinant Protein |
Species/Host | Virus |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 19.2 kDa |
UniProt ID | P17401 |
Protein Sequence | MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | HBx;Peptide X;pX. Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
7.9 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.5 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
7.8 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.0 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.5 kDa | |
E.Coli |
Filter by Rating