You have no items in your shopping cart.
Cart summary
X Recombinant Protein
Catalog Number: orb2054787
| Catalog Number | orb2054787 |
|---|---|
| Category | Proteins |
| Description | X Recombinant Protein |
| Species/Host | Virus |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.6 kDa |
| UniProt ID | P03165 |
| Protein Sequence | MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA |
| Source | E.coli |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | HBx;Peptide X;pX. Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human GROA protein (Active) [orb359047]
> 97% as determined by SDS-PAGE and HPLC.
7.9 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 2
Human SDF1 protein (Active) [orb359059]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Mouse GROA protein (Active) [orb359089]
> 97% as determined by SDS-PAGE and HPLC.
7.8 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 2
Mouse SDF1 protein (Active) [orb359099]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Mouse SDF1 protein (Active) [orb359100]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
