WT1 antibody

• Catalog Number: orb329950
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: WT1
• UniProt ID: P19544
• Protein Sequence: Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
• NCBI: NP_077742
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-2310001G03Rik antibody, anti-PAR 4 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The middle peptide is contained within multiple isoforms of this protein from 63 kDa to 33 kDa (~10 isoforms), and at least 4 of these isoforms seem represented in samples shown (63 kDa, 47-49 kDa, 40 kDa, and 33 kDa).

Host: Mouse, Target Name: WT1, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: WT1, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Human Testis

WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.