You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329950 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to WT1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WT1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | WT1 |
UniProt ID | P19544 |
Protein Sequence | Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA |
NCBI | NP_077742 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Anti-2310001G03Rik antibody, anti-PAR 4 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The middle peptide is contained within multiple isoforms of this protein from 63 kDa to 33 kDa (~10 isoforms), and at least 4 of these isoforms seem represented in samples shown (63 kDa, 47-49 kDa, 40 kDa, and 33 kDa).
Host: Mouse, Target Name: WT1, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: WT1, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.
Human Testis
WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.
IHC-P, WB | |
Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating