WNT7B antibody

• Catalog Number: orb577994
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WNT7B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT7B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39 kDa
• Target: WNT7B
• UniProt ID: P56706
• Protein Sequence: Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
• NCBI: NP_478679
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

Host: Mouse, Target Name: WNT7B, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: WNT7B, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: WNT7B, Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

Host: Rabbit, Target Name: WNT7B, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: WNT7B, Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: WNT7B, Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.