You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330602 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to WNT3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 37kDa |
Target | WNT3 |
UniProt ID | P56703 |
Protein Sequence | Synthetic peptide located within the following region: SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE |
NCBI | NP_110380 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti INT4 antibody, anti MGC131950 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: WNT3, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
WB Suggested Anti-WNT3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
ICC, IF, IHC-P, WB | |
Guinea pig, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating