WaTx

• Catalog Number: orb1140661
• Category: Proteins
• Description: Stabilizes the transient receptor potential cation channel 1 (TRPA1) in an active state; Peptides.
• Modifications: Disulphide bridges between cysteine 9 and cysteine 27 and cysteine 13 and cysteine 23.
• Structure: H-Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser-OH (disulphide bridge between C9 and C27 and C13 and C23)
• Target Areas: Transient receptor potential (TRP) channels
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 3855.3 Da
• Formula: C₁₆₄H₂₄₅N₄₅O₅₃S₅
• Solubility (25°C): Soluble in DMSO as stock.
• Protein Sequence: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
• Storage: Storage desiccated, frozen and in the dark
• Alternative names: Wasabi receptor toxin
• Background: WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.