You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604501 |
---|---|
Category | Proteins |
Description | Recombinant Vaccinia virus Protein A33(A33R),partial |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 17.8 kDa |
UniProt ID | P68616 |
Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Vaccinia virus (strain Copenhagen) (VACV) |
Expression Region | 57-185aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | A33RProtein A33 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
21.7 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
16.2 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
18.3 kDa | |
Baculovirus |
ELISA, SDS-PAGE, WB | |
> 90% as determined by SDS-PAGE | |
14.95 kDa | |
E. coli |
ELISA, SDS-PAGE, WB | |
Unconjugated | |
> 90% as determined by SDS-PAGE | |
14.95 kDa |
Filter by Rating