Cart summary

You have no items in your shopping cart.

    Villin/VIL1 Antibody

    Catalog Number: orb259634

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb259634
    CategoryAntibodies
    DescriptionVillin/VIL1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW92695 MW
    UniProt IDP09327
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesVillin-1;VIL1;VIL;
    Read more...
    NoteFor research use only
    Application notesWB: The detection limit for Villin is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Villin/VIL1 Antibody

    Flow Cytometry analysis of CACO-2 cells using anti-Villin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

    Villin/VIL1 Antibody

    WB analysis of Villin using anti-Villin antibody.Lane 1:Rat Intestine Tissue2:Mouse Kidney Tissue3:RH35 Cell4:HEPG2 Cell;5:MCF-7 Cell.

    Villin/VIL1 Antibody

    IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of rat intestine tissues.

    Villin/VIL1 Antibody

    IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of mouse intestine tissues.

    Villin/VIL1 Antibody

    IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of human rectal cancer tissues.

    Villin/VIL1 Antibody

    IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human ileum tissue.

    Villin/VIL1 Antibody

    IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human colon organoid tissue.

    Villin/VIL1 Antibody

    IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum tissue.

    Villin/VIL1 Antibody

    IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum organoid tissue.

    Villin/VIL1 Antibody

    IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of human intestinal cancer tissue.

    Villin/VIL1 Antibody

    IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of mouse intestine tissue.

    Villin/VIL1 Antibody

    IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of rat intestine tissue.

    • Villin Antibody [orb386095]

      IHC-P,  WB

      Human

      Mouse

      Monoclonal

      Unconjugated

      100 μg, 20 μg
    • Villin Antibody [orb386106]

      IHC-P,  WB

      Human

      Mouse

      Monoclonal

      Unconjugated

      100 μg, 20 μg
    • Villin (VIL1) antibody [orb1317948]

      IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Villin (VIL1) antibody [orb1311117]

      ChIP,  IHC

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      30 μl
    • Villin (VIL1) antibody [orb1311338]

      ChIP,  IHC

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars