You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb259634 |
---|---|
Category | Antibodies |
Description | Villin/VIL1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 92695 MW |
UniProt ID | P09327 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Villin-1;VIL1;VIL; Read more... |
Note | For research use only |
Application notes | WB: The detection limit for Villin is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of CACO-2 cells using anti-Villin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.
WB analysis of Villin using anti-Villin antibody.Lane 1:Rat Intestine Tissue2:Mouse Kidney Tissue3:RH35 Cell4:HEPG2 Cell;5:MCF-7 Cell.
IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of rat intestine tissues.
IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of mouse intestine tissues.
IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of human rectal cancer tissues.
IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human ileum tissue.
IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human colon organoid tissue.
IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum tissue.
IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum organoid tissue.
IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of mouse intestine tissue.
IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of rat intestine tissue.
Filter by Rating