You have no items in your shopping cart.
Cart summary
Venom dipeptidyl peptidase 4 Protein, Apis mellifera, Recombinant (His & Myc)
Catalog Number: orb1979843
| Catalog Number | orb1979843 |
|---|---|
| Category | Proteins |
| Description | Venom dipeptidyl-peptidase which removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. May process promelittin into its active form and/or modulate the chemotactic activity of immune cells after the insect sting. Venom dipeptidyl peptidase 4 Protein, Apis mellifera, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.4 kDa and the accession number is B2D0J4. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 36.4 kDa (predicted) |
| UniProt ID | B2D0J4 |
| Protein Sequence | KSVPRVIDQDLERYEPLEEEDHRGARVPFNLEETYDQSFRANSFNGTWKTDREILYSDNYVGDIRLFDVTTGSGTVLLDSSVTADFDKASVMFSFDNSHVAIGHDYVNGFRYSIHQKCTVYNIKSRTFTDIANGDRIPLFKWSPTRNALIYVHKNDIYYQVFFEGGSDTRRITNTGVPDIVFNGIPDWVYEEEVLGSPVAFWISPDGRHLAFATFNDTNVRDIVISKYGSPGNSRDQYPNEIRIKYPKAGTTN |
| Expression System | E. coli |
| Biological Origin | Apis mellifera |
| Biological Activity | Venom dipeptidyl-peptidase which removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. May process promelittin into its active form and/or modulate the chemotactic activity of immune cells after the insect sting. Venom dipeptidyl peptidase 4 Protein, Apis mellifera, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.4 kDa and the accession number is B2D0J4. |
| Expression Region | 24-276 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
