You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575400 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VDAC3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | VDAC3 |
UniProt ID | Q9Y277 |
Protein Sequence | Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
NCBI | NP_005653 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | VDAC-3, HD-VDAC3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: VDAC3, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. VDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: VDAC3, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: VDAC3, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-VDAC3 antibody, Catalog Number: orb575400, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-VDAC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating