You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329811 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VDAC2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | VDAC2 |
UniProt ID | P45880 |
Protein Sequence | Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN |
NCBI | NP_003366 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ23841 antibody, anti POR antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Brain tissue using VDAC2 antibody
Western blot analysis of 293T cell lysate tissue using VDAC2 antibody
Host: Rabbit, Target Name: VDAC2, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Rabbit Anti-VDAC2 Antibody, Catalog Number: orb329811, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-VDAC2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, VDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating