You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329810 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VDAC2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32 kDa |
Target | VDAC2 |
UniProt ID | P45880 |
Protein Sequence | Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
NCBI | NP_003366 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti RP11-375G3.1 antibody, anti FLJ23841 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Bronchial Epithelial tissue using VDAC2 antibody
Western blot analysis of human cell lines tissue using VDAC2 antibody
Western blot analysis of Transfected 293T tissue using VDAC2 antibody
WB Suggested Anti-VDAC2 Antibody, Titration: 1.6 ug/mL, Positive Control: human cell lines.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment.
Rabbit Anti-VDAC2 Antibody, Catalog Number: orb329810, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-VDAC2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Transfected 293TVDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T.
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
WB | |
Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating