You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2055686 |
---|---|
Category | Proteins |
Description | VCATH Recombinant Protein |
Species/Host | Virus |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 39.9 kDa |
UniProt ID | P25783 |
Protein Sequence | PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY |
Source | E.coli |
NCBI | NP_054157.1 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | ACNVgp128;AcOrf-127;Cysteine proteinase;viral cath Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
39.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
39.9 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
39.9 kDa | |
E.coli |
Filter by Rating