VANGL2 antibody

• Catalog Number: orb588946
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VANGL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VANGL2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60 kDa
• Target: VANGL2
• UniProt ID: Q9ULK5
• Protein Sequence: Synthetic peptide located within the following region: SSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTRGDERDDNW
• NCBI: NP_065068.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LPP1, LTAP, STB1, STBM, STBM1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: VANGL2, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: VANGL2, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/ml.

Host: Rabbit, Target Name: VANGL2, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.

Host: Rabbit, Target Name: VANGL2, Sample Tissue: Human Lymph Node Tumor, Antibody Dilution: 1.0 ug/ml.