You have no items in your shopping cart.
Cart summary
![VACWR034 Recombinant Protein [Out of stock]](/images/quality-badge_250x250_1.png){kind=icon}
VACWR034 Recombinant Protein [Out of stock]
Catalog Number: orb2054794
| Catalog Number | orb2054794 |
|---|---|
| Category | Proteins |
| Description | VACWR034 Recombinant Protein [Out of stock] |
| Species/Host | Virus |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 12.6 kDa |
| UniProt ID | P18378 |
| Protein Sequence | MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ |
| Source | Yeast |
| NCBI | YP_232916.1 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | interferon resistance protein;Protein K2;VACWR034. Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
