You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330628 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UXT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UXT |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 18 kDa |
Target | UXT |
UniProt ID | Q9UBK9 |
Protein Sequence | Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL |
NCBI | NP_705582 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti ART-27 antibody, anti STAP1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 cell lysate tissue using UXT antibody
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-UXT Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.
Filter by Rating