You have no items in your shopping cart.
Cart summary
USP7 Protein, Human, Recombinant (His & Myc & SUMO)
Catalog Number: orb1977633
| Catalog Number | orb1977633 |
|---|---|
| Category | Proteins |
| Description | USP7 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 55.6 kDa and the accession number is Q93009. |
| Tag | N-10xHis-SUMO, C-Myc |
| Purity | 98.00% |
| MW | 55.6 kDa (predicted) |
| UniProt ID | Q93009 |
| Protein Sequence | VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | USP7 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 55.6 kDa and the accession number is Q93009. |
| Expression Region | 214-521 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
