You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331034 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to USP47 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP47 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 147kDa |
Target | USP47 |
UniProt ID | B3KXF5 |
Protein Sequence | Synthetic peptide located within the following region: SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP |
NCBI | NP_060414 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp686C13257 antibody, anti FLJ20727 antibo Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: USP47, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: USP47, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-USP47 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, USP47 is supported by BioGPS gene expression data to be expressed in ACHN.
ICC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating