USP15 antibody

• Catalog Number: orb331033
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human USP15
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 109kDa
• Target: USP15
• UniProt ID: Q9Y4E8
• Protein Sequence: Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED
• NCBI: NP_006304
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA0529 antibody, anti MGC131982 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence Sample Type: A549 & HEK293T cells. Primary dilution: 1:500.

USP15 antibody - C-terminal region (orb331033) validated by WB using A549 and HEK293T cells at 1: 500.

WB Suggested Anti-USP15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.