You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694944 |
---|---|
Category | Proteins |
Description | Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with Ki values of 13.5, 21.7, and > 100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion. |
CAS Number | 357952-09-1 |
Purity | ≥95% |
MW | 4137.96 |
Formula | C185H307N53O50S2 |
Target | CRFR |
Protein Sequence | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
20.1 kDa | |
E.coli |
Human | |
6.25 pg/mL-400 pg/mL | |
1.56 pg/mL |
Greater than 85% as determined by SDS-PAGE. | |
17.7 kDa | |
E.coli |