You have no items in your shopping cart.
Cart summary
UL111A Recombinant Protein
Catalog Number: orb2055606
| Catalog Number | orb2055606 |
|---|---|
| Category | Proteins |
| Description | UL111A Recombinant Protein |
| Species/Host | Virus |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34 kda |
| UniProt ID | P17150 |
| Protein Sequence | SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK |
| Source | E.coli |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | cmvIL-10 vIL-10 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human UL111A protein [orb358430]
Greater than 90% as determined by SDS-PAGE.
34 kDa
E.coli
20 μg, 100 μg, 1 mgHuman UL111A protein [orb418862]
Greater than 90% as determined by SDS-PAGE.
17.5 kDa
E.coli
20 μg, 100 μg, 1 mgViral UL111A protein [orb54205]
Greater than 85% as determined by SDS-PAGE.
36.0 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
