You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2055606 |
---|---|
Category | Proteins |
Description | UL111A Recombinant Protein |
Species/Host | Virus |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34 kda |
UniProt ID | P17150 |
Protein Sequence | SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | cmvIL-10 vIL-10 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
34 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
17.5 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
36.0 kDa | |
E.coli |
Filter by Rating