You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575258 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UHRF2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UHRF2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 90 kDa |
Target | UHRF2 |
UniProt ID | Q96PU4 |
Protein Sequence | Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART |
NCBI | NP_690856 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NIRF, URF2, RNF107, TDRD23 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~56 kDa.
Host: Rabbit, Target Name: UHRF2, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target: UHRF2, Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 0.1 ug/ml.
Human Heart
WB Suggested Anti-UHRF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating