UHRF2 antibody

• Catalog Number: orb575258
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UHRF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UHRF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 90 kDa
• Target: UHRF2
• UniProt ID: Q96PU4
• Protein Sequence: Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART
• NCBI: NP_690856
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NIRF, URF2, RNF107, TDRD23
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~56 kDa.

Host: Rabbit, Target Name: UHRF2, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 0.5 ug/ml.

Host: Rabbit, Target: UHRF2, Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 0.1 ug/ml.

Human Heart

WB Suggested Anti-UHRF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.