You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334638 |
---|---|
Category | Antibodies |
Description | UHRF1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 89814 MW |
UniProt ID | Q96T88 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | E3 ubiquitin-protein ligase UHRF1;6.3.2.-;Inverted Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-UHRF1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of A431 cells using anti-UHRF1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of UHRF1 using anti-UHRF1 antibody.Lane 1:HEK293 cell; 2:T-47D cell; 3:A549 cell; 4:HepG2 cell; 5:MDA-MB-453 cell;6:Raji cell.
IF analysis of UHRF1 using anti-UHRF1 antibody. UHRF1 was detected in immunocytochemical section of U20S cells.
IHC analysis of UHRF1 using anti-UHRF1 antibody. UHRF1 was detected in a paraffin-embedded section of human intestinal cancer tissue.
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating