You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583318 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UCHL5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UCHL5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38 kDa |
Target | UCHL5 |
UniProt ID | Q9Y5K5 |
Protein Sequence | Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
NCBI | NP_057068 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | UCH37, CGI-70, INO80R, UCH-L5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Peptide is also present in some higher mw isoforms including 45 kDa, and the protein may be modified by acetylation or succinylation.
WB Suggested Anti-UCHL5 Antibody, Positive Control: Lane 1: 30 ug Zebrafish skin lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:4000.
WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.
ICC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating