UCHL3 antibody

• Catalog Number: orb584084
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UCHL3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UCHL3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26 kDa
• Target: UCHL3
• UniProt ID: P15374
• Protein Sequence: Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC
• NCBI: NP_005993
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: UCH-L3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-UCHL3 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UCHL3 antibody orb584084 concentration 5 ug/ml.

WB Suggested Anti-UCHL3 Antibody, Positive Control: Lane 1: 30 ug Zebrafish skin lysate, Lane 2: 30 ug Zebrafish liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:4000.

WB Suggested Anti-UCHL3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.