You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582568 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBQLN1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBQLN1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | UBQLN1 |
UniProt ID | Q5T6J9 |
Protein Sequence | Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA |
NCBI | NP_038466 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DA41, DSK2, UBQN, XDRP1, PLIC-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-UBQLN1 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.
Anti-UBQLN1 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. UBQLN1 Antibody orb582568 concentration 5 ug/ml.
Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-UBQLN1 antibody (orb582568).
WB Suggested Anti-UBQLN1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate.
IF, IH, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating