You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578661 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE3A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE3A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 101kDa |
Target | UBE3A |
UniProt ID | Q05086 |
Protein Sequence | Synthetic peptide located within the following region: AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML |
NCBI | NP_000453 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AS, ANCR, E6-AP, HPVE6A, EPVE6AP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: UBE3A, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: UBE3A, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Lanes: Lane 1: 7 ug HeLa lysate+EGFP SiRNA, Lane 2: 7 ug HeLa lysate+UBE3A SiRNA, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Gene Name: UBE3A.
WB Suggested Anti-UBE3A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate. UBE3A is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ICC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating