You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574525 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE2N |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2N |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17kDa |
Target | UBE2N |
UniProt ID | P61088 |
Protein Sequence | Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE |
NCBI | NP_003339 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | UBC13, UbcH13, HEL-S-71, UbcH-ben, UBCHBEN; UBC13 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit from, Secondary Antibody dilution: 1:20000.
Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:50000, Gene Name: UBE2N.
Sample Type: Mouse brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: UBE2N: Red DAPI:Blue, Gene Name: UBE2N.
WB Suggested Anti-UBE2N Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate, UBE2N is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ELISA, FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Drosophila, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Canine, Drosophila, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating