UBE2I Rabbit Polyclonal Antibody

• Catalog Number: orb330272
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2I
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: UBE2I
• UniProt ID: P63279
• Protein Sequence: Synthetic peptide located within the following region: MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
• NCBI: NP_003336
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C358B7.1 antibody, anti P18 antibody, anti UB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-UBE2I Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that UBE2I is expressed in Jurkat.