You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291998 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant UBE2D2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4A1 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | UBE2D2 (NP_003330, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS |
NCBI | NP_003330 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged UBE2D2 is approximately 3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to UBE2D2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
UBE2D2 monoclonal antibody (M02), clone 4A1 Western Blot analysis of UBE2D2 expression in NIH/3T3.
UBE2D2 monoclonal antibody (M02), clone 4A1. Western Blot analysis of UBE2D2 expression in PC-12.
UBE2D2 monoclonal antibody (M02), clone 4A1. Western Blot analysis of UBE2D2 expression in Raw 264.7.
Western Blot detection against Immunogen (36.08 KDa).