UBE2D2 Rabbit Polyclonal Antibody

• Catalog Number: orb578680
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2D2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2D2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17 kDa
• Target: UBE2D2
• UniProt ID: P62837
• Protein Sequence: Synthetic peptide located within the following region: SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
• NCBI: NP_003330
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Human Lung

WB Suggested Anti-UBE2D2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.