You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578680 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE2D2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2D2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17 kDa |
Target | UBE2D2 |
UniProt ID | P62837 |
Protein Sequence | Synthetic peptide located within the following region: SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE |
NCBI | NP_003330 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Human Lung
WB Suggested Anti-UBE2D2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating