You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578679 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to UBE2D2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 17kDa |
Target | UBE2D2 |
UniProt ID | P62837 |
Protein Sequence | Synthetic peptide located within the following region: ALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFF |
NCBI | NP_003330 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1: 40 ng HIS-UBE2D1 protein, 2: 40 ng HIS-UBE2D2 protein, 3: 40 ng HIS-UBE2D3 protein, 4: 40 ng HIS-UBE2D4 protein, 5: 40 ng HIS-UBE2E1 protein, 6: 40 ng HIS-UBE2E2 protein, 7: 40 ng HIS-UBE2E3 protein, 8: 40 ng HIS-UBE2K protein, 9: 40 ng HIS-UBE2L3 protein, 10: 40 ng HIS-UBE2N protein, 11: 40 ng HIS-UBE2V1 protein, 12: 40 ng HIS-UBE2V2 protein. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:50000, Gene Name: UBE2D2.
WB Suggested Anti-UBE2D2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating